PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009611974.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 364aa    MW: 42039.1 Da    PI: 4.9387
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009611974.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.43.9e-5581371129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeelv +yL+kk++++k++l +vi+++d+y++ePwdL+ k    ++e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v
  XP_009611974.1   8 VPPGFRFHPTDEELVGYYLRKKIASQKIDL-DVIRDIDLYRIEPWDLRdKcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAV 101
                     69****************************.9***************843432233667************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     ++ k +l+g++ktLvfykgrap+g+ktdW+mheyrle
  XP_009611974.1 102 YD-KLKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 137
                     **.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-605157IPR003441NAC domain
PROSITE profilePS5100559.2618157IPR003441NAC domain
PfamPF023659.9E-299136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MDTNESCVPP GFRFHPTDEE LVGYYLRKKI ASQKIDLDVI RDIDLYRIEP WDLRDKCRIG  60
YEEQNEWYFF SHKDKKYPTG TRTNRATMAG FWKATGRDKA VYDKLKLIGM RKTLVFYKGR  120
APNGQKTDWI MHEYRLESED NGPPQEEGWV VCRAFKKKIT GQTKTNMGEG WESNYFYEEA  180
TTAVSLVVDP LEYITRQPLP PNFMAQNLLC KQEMELAENN NLNFPYNSDQ FVQLPQLQSP  240
SLPLIKRPIS SMSLVSENSN QEDDEQTINK RCSTINSSTS KNVTADWRAL DKFVASQLSH  300
DNHEQERTYE TNHGLLSSFE EEAHNYSDLG MLLLLSDREE GPKLNEILSS SSDGCDIGVC  360
IFDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D4e-50816220173NAC domain-containing protein 19
3swp_C4e-50816220173NAC domain-containing protein 19
3swp_B4e-50816220173NAC domain-containing protein 19
3swp_A4e-50816220173NAC domain-containing protein 19
3swm_D4e-50816220173NAC domain-containing protein 19
3swm_C4e-50816220173NAC domain-containing protein 19
3swm_B4e-50816220173NAC domain-containing protein 19
3swm_A4e-50816220173NAC domain-containing protein 19
4dul_B4e-50816217170NAC domain-containing protein 19
4dul_A4e-50816217170NAC domain-containing protein 19
1ut7_B4e-50816217170NO APICAL MERISTEM PROTEIN
1ut7_A4e-50816217170NO APICAL MERISTEM PROTEIN
1ut4_B4e-50816217170NO APICAL MERISTEM PROTEIN
1ut4_A4e-50816217170NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016515338.10.0PREDICTED: NAC domain-containing protein 37-like
SwissprotQ9SL411e-155NAC37_ARATH; NAC domain-containing protein 37
TrEMBLM0ZVN60.0M0ZVN6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000091360.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-145vascular related NAC-domain protein 1